1.67 Rating by CuteStat

istanbulboyaustasi.net is 7 years 10 months old. It is a domain having net extension. It has a global traffic rank of #11657160 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, istanbulboyaustasi.net is SAFE to browse.

PageSpeed Score
52
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 41
Daily Pageviews: 82

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 11,657,160
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

77.92.140.32

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948
İstanbul Boya Ustası | Bir başka WordPress sitesi

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 77.92.140.32)

Kötü Sözlük'tü.

- kotusozluk.com
4,085,720 $ 240.00

Tam Haber | Güncel Haberler ve Son Dakika Haberleri

- tamhaber.com.tr

Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.

7,102,027 $ 240.00

Index of /

- chicopeekedikopekmamalari.com
Not Applicable $ 8.95

Maya Cupcake | Harika Cupcake Çeşitleri

- mayacupcake.com

Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.

19,998,643 $ 8.95

Index of /

- tuvalettikanikligiacmafiyatlari.net
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 04 Jul 2016 17:14:36 GMT
Server: Apache/2.4.16 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.45
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://www.istanbulboyaustasi.net/xmlrpc.php
Link: <http://www.istanbulboyaustasi.net/wp-json/>; rel="https://api.w.org/", <http://www.istanbulboyaustasi.net/>; rel=shortlink
Content-Length: 20608
Connection: close
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: FBS INC.
Registration Date: May 30, 2016, 12:00 AM 7 years 10 months 4 weeks ago
Last Modified: May 30, 2016, 12:00 AM 7 years 10 months 4 weeks ago
Expiration Date: May 30, 2017, 12:00 AM 6 years 10 months 4 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.kotuhost.com 212.68.61.245 Türkiye Türkiye
ns2.kotuhost.com 212.68.61.231 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
istanbulboyaustasi.net A 14373 IP: 77.92.140.32
istanbulboyaustasi.net NS 86400 Target: ns1.kotuhost.com
istanbulboyaustasi.net NS 86400 Target: ns2.kotuhost.com
istanbulboyaustasi.net SOA 86400 MNAME: ns1.kotuhost.com
RNAME: destek.labina.com.tr
Serial: 2016053003
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
istanbulboyaustasi.net MX 14400 Target: istanbulboyaustasi.net
istanbulboyaustasi.net TXT 14400 TXT: v=spf1 +a +mx +ip4:77.92.140.32 ~all

Similarly Ranked Websites


Dear Crissy - Easy Dinner Ideas

- parentpretty.com

Easy dinner ideas for busy families.

11,657,176 $ 8.95

Торговое оборудование в Казахстане. Интернет магазин - Торговый Стиль

- ollo.kz

Магазин торгового оборудования в Казахстане. Торговое оборудование отправляется в города Казахстана: Алматы, Астана, Усть-Каменогорск, Караганда, Павлодар, Актау, Атырау, Семей, Кокчетав, Темиртау, Актобе, Жезказган, Тараз

11,657,180 $ 8.95

PT. China Health International

- chiindo.com

suplemen herbal kesehatan terkemuka dan terpercaya, meliputi pine pollen, pine pollen coffee, pine pollen digestive formula, pine pollen ginseng essence, pine pollen toxilox, bamboo Leaf Essence, bamboo Leaf Health Tea

11,657,190 $ 8.95

Prem Singh Basnyat | Nepalese Army In The History Of Nepal

- premsinghbasnyat.com.np
11,657,217 $ 8.95

Full WHOIS Lookup

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: ISTANBULBOYAUSTASI.NET
Registrar: FBS INC.
Sponsoring Registrar IANA ID: 1110
Whois Server: whois.isimtescil.net
Referral URL: http://www.isimtescil.net
Name Server: NS1.KOTUHOST.COM
Name Server: NS2.KOTUHOST.COM
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Updated Date: 30-may-2016
Creation Date: 30-may-2016
Expiration Date: 30-may-2017

>>> Last update of whois database: Mon, 04 Jul 2016 17:14:40 GMT